1. N_LaRUE's Avatar
    I'm downloading the update and will give it trial before deciding to purchase. :)
    Laura Knotek likes this.
    11-22-2013 03:31 AM
  2. N_LaRUE's Avatar
    I still have the issue with images in the forum. :(
    11-22-2013 03:41 AM
  3. LMZR's Avatar
    So I joined Instagram to give it a swing. The problem now is I see everything through a filter....
    My problem is that most of my friends are younger than me, so more immature, and there is more bullcrap on my feed, most of my pictures are band releated and well... Some are pointless.
    11-22-2013 03:57 AM
  4. LMZR's Avatar
    I'm downloading the update and will give it trial before deciding to purchase. :)
    I already bought it, but the live tiles aren't working. :\
    11-22-2013 03:57 AM
  5. N_LaRUE's Avatar
    My problem is that most of my friends are younger than me, so more immature, and there is more bullcrap on my feed, most of my pictures are band releated and well... Some are pointless.
    Yeah being around that age is always difficult. I had similar issues when I was growing up. I ended up getting new friends, which wasn't a bad thing.

    I have a professional photographer as a friend so get some good pics. :)
    11-22-2013 04:02 AM
  6. N_LaRUE's Avatar
    I already bought it, but the live tiles aren't working. :\
    That suciks. I'm not going to buy it while it still has the view images problem.
    11-22-2013 04:02 AM
  7. LMZR's Avatar
    Yeah being around that age is always difficult. I had similar issues when I was growing up. I ended up getting new friends, which wasn't a bad thing.

    I have a professional photographer as a friend so get some good pics. :)
    I like photography, but all of the devices i own have 5MP cameras, with the Mozart having an 8MP camera, but it's similar to my 520.

    That will change once i get my 1520.
    11-22-2013 04:05 AM
  8. N_LaRUE's Avatar
    That will change once i get my 1520.
    I'm not really into the large phones but to each their own. I'm quite happy with the size of my 920 and it takes great pics. :)

    I'm not sure what phone I'll get next. Probably won't be for another year at least.
    11-22-2013 04:09 AM
  9. LMZR's Avatar
    I'm not really into the large phones but to each their own. I'm quite happy with the size of my 920 and it takes great pics. :)

    I'm not sure what phone I'll get next. Probably won't be for another year at least.
    Well, i like the updated specifications, 32GB of storage with MicroSD, i could use it for gaming, music, photography, productivity and hopefully i can use the 4 HAAC microphones to record some new stuff with my band. :)
    MSFTisMIA likes this.
    11-22-2013 04:16 AM
  10. N_LaRUE's Avatar
    Well, i like the updated specifications, 32GB of storage with MicroSD, i could use it for gaming, music, photography, productivity and hopefully i can use the 4 HAAC microphones to record some new stuff with my band. :)
    Sounds like a plan.

    I've been meaning to mention my wife's cousin's from Finland to you. She has two cousins in the entertainment industry, both musical. They're like 3/4 cousins. Anyway, one used to be the lead singer of Kiuas Kiuas - Wikipedia, the free encyclopedia (Ilja Jalkanen) the group is no longer going (I thinki) and he's decided to go solo, the other is his sister who came second in a TV talent show similar to Idol and is now staring in Dr. Sheavago in Helsinki. Thought maybe you'd get a kick out of Kiuas.
    LMZR and Laura Knotek like this.
    11-22-2013 04:42 AM
  11. LMZR's Avatar
    Sounds like a plan.

    I've been meaning to mention my wife's cousin's from Finland to you. She has two cousins in the entertainment industry, both musical. They're like 3/4 cousins. Anyway, one used to be the lead singer of Kiuas Kiuas - Wikipedia, the free encyclopedia (Ilja Jalkanen) the group is no longer going (I thinki) and he's decided to go solo, the other is his sister who came second in a TV talent show similar to Idol and is now staring in Dr. Sheavago in Helsinki. Thought maybe you'd get a kick out of Kiuas.
    Interesting. Will have quite a look into the group, apparently they're heavy metal, so that's not really my thing, but i'll look into it anyway. :)
    11-22-2013 04:46 AM
  12. N_LaRUE's Avatar
    Interesting. Will have quite a look into the group, apparently they're heavy metal, so that's not really my thing, but i'll look into it anyway. :)
    Thing to keep in mind is that Finnish metal is a touch different than other places. Though some groups are very heavy. If you want something really different check out Nightwish.
    LMZR and azcruz like this.
    11-22-2013 04:49 AM
  13. Chregu's Avatar
    I haven't written anything for a while now. As I don't have anything to contribute to the topic, here a protein sequence.

    MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLT
    VAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
    N_LaRUE, LMZR and Laura Knotek like this.
    11-22-2013 05:04 AM
  14. N_LaRUE's Avatar
    I haven't written anything for a while now. As I don't have anything to contribute to the topic, here a protein sequence.
    There's a topic in this thread???? Who knew!
    LMZR and MSFTisMIA like this.
    11-22-2013 05:07 AM
  15. Chregu's Avatar
    There's a topic in this thread???? Who knew!
    Finnish metal and big phones I guess...
    Laura Knotek likes this.
    11-22-2013 05:21 AM
  16. N_LaRUE's Avatar
    Finnish metal and big phones I guess...
    Just a blip in an otherwise varied topic thread. :P At least it wasn't about cake or trip-tip or whatever...
    Chregu and Laura Knotek like this.
    11-22-2013 05:23 AM
  17. Chregu's Avatar
    Just a blip in an otherwise varied topic thread. :P At least it wasn't about cake or trip-tip or whatever...
    The clap (gonorrhoea) is called Tripper in German, and that's what I read at the first moment. However it's a trip-tip, much better to get that.
    N_LaRUE likes this.
    11-22-2013 05:26 AM
  18. N_LaRUE's Avatar
    The clap (gonorrhoea) is called Tripper in German, and that's what I read at the first moment. However it's a trip-tip, much better to get that.
    If only sahib was still on.... LOL!
    sahib lopez likes this.
    11-22-2013 05:28 AM
  19. azcruz's Avatar
    Ice cold beer





    Sent from my Windows Phone 8S by HTC using Tapatalk
    Attached Thumbnails wp_20131122_002.jpg  
    11-22-2013 06:11 AM
  20. MSFTisMIA's Avatar
    you know every time MIA posts something I always seem to picture him as common o.o I don't know why http://879thebeat.com/wp-content/upl.../06/common.jpg
    you're on to something there, although Common is way better looking than me. I still have hair on my head, but my skin tone is similar to his. I've posted my picture in the "what we all look like thread".
    sahib lopez likes this.
    11-22-2013 06:22 AM
  21. MSFTisMIA's Avatar
    The clap (gonorrhoea) is called Tripper in German, and that's what I read at the first moment. However it's a trip-tip, much better to get that.
    It's even better to get tri-tip, that sandwich sahib is always on. STDs are no fun to deal with. I've gotten the gamut of reactions to a +STD diagnosis, and it is always stressful...
    11-22-2013 06:33 AM
  22. MSFTisMIA's Avatar
    Morning folks, just browsing briefly before I leave the house to head to work. Will catch up on my reading of the posts here during the train ride, as usual...
    11-22-2013 06:34 AM
  23. N_LaRUE's Avatar
    you're on to something there, although Common is way better looking than me. I still have hair on my head, but my skin tone is similar to his. I've posted my picture in the "what we all look like thread".
    Found you on page 10. That took some time. :P

    You look like a very friendly guy. :)

    I haven't posted a pic yet... not sure if I will. I haven't got a pic for LinkedIn yet and that's my business calling card. I'm working on losing weight so I'm waiting until then. :)
    MSFTisMIA likes this.
    11-22-2013 06:38 AM
  24. Chregu's Avatar
    It's even better to get tri-tip, that sandwich sahib is always on. STDs are no fun to deal with. I've gotten the gamut of reactions to a +STD diagnosis, and it is always stressful...
    Well, at least a bacterial STD can be treated. A viral one is a companion forever.
    11-22-2013 07:43 AM
  25. Chregu's Avatar
    I haven't posted a pic yet...
    I haven't either and I probably won't. I am sure all of you imagine me much different than I really am, I think that is a nice thought.
    11-22-2013 07:46 AM
145,259 ... 690691692693694 ...

Similar Threads

  1. WC app: Can't log on?
    By Nogitsune Micah in forum Windows Central for Windows Phone - App Support
    Replies: 18
    Last Post: 10-23-2014, 07:53 AM
  2. Do you use HipChat? Tell them why you want a native app for Windows Phone
    By WindowsCentral.com in forum Windows Central News Discussion
    Replies: 0
    Last Post: 10-22-2014, 02:42 PM

Tags for this Thread

LINK TO POST COPIED TO CLIPBOARD